PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_6371_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 251aa    MW: 28015.9 Da    PI: 9.5276
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_6371_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.63.2e-193984147
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         +g+W++eEd++l ++v+++G+++W++I++++  gR++k+c++rw + 
  cra_locus_6371_iso_1_len_1340_ver_3 39 KGPWSAEEDKILTRLVEKYGPRNWSLISKYIK-GRSGKSCRLRWCNQ 84
                                         79*****************************9.***********985 PP

2Myb_DNA-binding54.62.5e-1793135347
                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +++  Ede ++ a++++G++ W+tIar ++ gRt++ +k++w++ 
  cra_locus_6371_iso_1_len_1340_ver_3  93 PFSSSEDETILAAHAKYGNR-WATIARLLP-GRTDNAVKNHWNST 135
                                          799*****************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.5853489IPR017930Myb domain
SuperFamilySSF466896.11E-3236132IPR009057Homeodomain-like
SMARTSM007171.8E-173887IPR001005SANT/Myb domain
PfamPF002497.9E-193984IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-254092IPR009057Homeodomain-like
CDDcd001671.78E-154183No hitNo description
SMARTSM007173.4E-1590138IPR001005SANT/Myb domain
PROSITE profilePS5129419.97291140IPR017930Myb domain
PfamPF002493.3E-1493135IPR001005SANT/Myb domain
CDDcd001672.61E-1193136No hitNo description
Gene3DG3DSA:1.10.10.608.5E-2393139IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MDSFYRCSST TAAATSSSSD SSSSDSSGRK NGTKPERIKG PWSAEEDKIL TRLVEKYGPR  60
NWSLISKYIK GRSGKSCRLR WCNQLSPNVE HRPFSSSEDE TILAAHAKYG NRWATIARLL  120
PGRTDNAVKN HWNSTLKRRY QQQNQNHQQE IQIIGGANVK NDDVSRSVSV NNSSSSRVFP  180
LVDYDESDPM TILSLAPPGY HELPATTTTT ERQQAENFPA GFWDAMKNVI AREVREYVAS  240
SFSATSSSGF H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-433513954158MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-433513954158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074463.11e-100PREDICTED: transcription factor MYB44-like
RefseqXP_011083803.11e-100PREDICTED: transcription factor MYB44-like
TrEMBLA0A068UH831e-114A0A068UH83_COFCA; Uncharacterized protein
STRINGGLYMA06G04010.18e-90(Glycine max)
STRINGSolyc04g079360.1.11e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA79502131